PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0614s0011.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family S1Fa-like
Protein Properties Length: 76aa    MW: 8037.62 Da    PI: 10.8655
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0614s0011.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA125.12.2e-39975470
                 S1FA  4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                         +++  +G+n Glivllvv g+l++flvgny+lyvyaqk+lPPrkkkPvskkklkre+lkqGv++PGe
  Kalax.0614s0011.1.p  9 VNAGGQGFNAGLIVLLVVVGILVTFLVGNYVLYVYAQKTLPPRKKKPVSKKKLKRERLKQGVSAPGE 75
                         455569************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.4E-371375IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MDGDLGAKVN AGGQGFNAGL IVLLVVVGIL VTFLVGNYVL YVYAQKTLPP RKKKPVSKKK  60
LKRERLKQGV SAPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.12e-27DNA-binding protein S1FA1
SwissprotQ7XLX64e-13S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLW9SCA32e-27W9SCA3_9R
STRINGSolyc09g007500.2.17e-15(Solanum lycopersicum)